DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and cntd1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_031750431.1 Gene:cntd1 / 100497368 XenbaseID:XB-GENE-5867609 Length:277 Species:Xenopus tropicalis


Alignment Length:146 Identity:33/146 - (22%)
Similarity:57/146 - (39%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SVALFKRF-----SDHFSCCKVFK--MKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNN 87
            :|.:..||     .|.|.....:|  |..|..:..|:....|..|.:|....|:. :.:.|:.:.
 Frog    77 AVEILDRFMILHVEDVFKTSAEYKNIMDRSQAEPWSSLKIRLCDTFMLHLASCVQ-IASKLYFHC 140

  Fly    88 HL---QIVLNF----GF----AVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQM 141
            |:   ..:|.|    |:    |.|:|.:             :||...::..|.|...|:|  .:|
 Frog   141 HIVNYNTILKFLGSAGYTYTKAELLASE-------------LTVLKTLHFHVNLLSPFSY--VEM 190

  Fly   142 LGAFIGY-GLLMVLLP 156
            |...:|: |..:.|.|
 Frog   191 LLEVLGHNGCSLSLRP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 24/110 (22%)
cntd1XP_031750431.1 CYCLIN_CNTD1 51..179 CDD:410244 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.