DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp5

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001297041.1 Gene:aqp5 / 100491662 XenbaseID:XB-GENE-479726 Length:289 Species:Xenopus tropicalis


Alignment Length:233 Identity:76/233 - (32%)
Similarity:122/233 - (52%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |...|.:.|.|.||.|....::........|||.|.||..:...:|..|.:||||:|||||::..
 Frog    13 AIFAEFLATLIFVFFGLGSALRWPAALPTVLQISLAFGLVIGTLVQSVGHISGAHINPAVTMSFL 77

  Fly   124 IYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVIT 188
            :...::|..||.|..||:||...|.|:|..:: ||  .|...|.:.....::|.|.|..:|.::|
 Frog    78 VGSQISLIRAFFYIIAQLLGGLAGAGILYGVV-SP--NVRGNLAINTLSNNITPGVAFVVEMILT 139

  Fly   189 SILVIVCCGVWDPRNSKFHDSVG---IRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFES 250
            ..||:  | ::...:|:..|:||   :..||::.........|||.|||||||||||:..:.|.:
 Frog   140 FQLVM--C-IFASTDSRREDNVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFAPAVVVRRFTN 201

  Fly   251 NWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKL 288
            :|::|:.||:...:.:..|..:    :..:..|.::||
 Frog   202 HWVFWIGPLAGGMLASLTYNYI----LFPSTKTRSQKL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 73/215 (34%)
aqp5NP_001297041.1 MIP 4..220 CDD:333943 72/212 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.