DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and LOC100489930

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_002940511.2 Gene:LOC100489930 / 100489930 -ID:- Length:297 Species:Xenopus tropicalis


Alignment Length:267 Identity:81/267 - (30%)
Similarity:119/267 - (44%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HFSCCKVFKMKGSTLDK-ISAFLGELIGTGILVFLGCMGCVKTDL--FPN-NHLQIVLNFGFAVL 100
            |.:..|..|:|..|.:: :...|.|.:||.||:..||....:.:|  |.. ..|.:.:.|||||.
 Frog     4 HLAFLKNMKIKLRTQNQYVRCGLAEFLGTLILILFGCGSVAQMELSGFAKAQFLSVNMAFGFAVT 68

  Fly   101 I-AIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL---------- 154
            . |..|.| ||||||||||::|.:|.:.::.|:...|..||.||||||..|:..|          
 Frog    69 AGAYVCAG-VSGAHLNPAVSLAMFILKKLSWRLLLTYCLAQFLGAFIGAALVFSLYYDALHVYSS 132

  Fly   155 ----LPSPTLTVGAGLCVTLP--HTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIR 213
                :..|..|  ||:..:.|  |.||..|  ...:.:.|:.|:|....:.|..|:.  ...|::
 Frog   133 GNWTVYGPQAT--AGIFASYPSEHLSVING--FTDQVIATAALLICILAILDEANNA--APRGLQ 191

  Fly   214 ---FGLAIACLACAAGPFTGGSMNPARSFAP------ALWNKHFESN-----WIYWLAPLSSSAI 264
               .|:.:..:..|.|...|..:||||..||      |.|.....|.     |:..:.||....:
 Frog   192 PFLIGIVVLLVGLAMGFNCGYPINPARDLAPRFFTAIAGWGSEVFSAGGHWWWVPVIGPLVGGVL 256

  Fly   265 TAYAYKV 271
            ....|:|
 Frog   257 GVVIYEV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 76/247 (31%)
LOC100489930XP_002940511.2 MIP 26..264 CDD:238204 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.