DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and sema4b

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_031755080.1 Gene:sema4b / 100489037 XenbaseID:XB-GENE-922109 Length:850 Species:Xenopus tropicalis


Alignment Length:98 Identity:23/98 - (23%)
Similarity:40/98 - (40%) Gaps:29/98 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALW 244
            ||.:.:.|::|..::|       :|||.:::..          |.......||  |.|||     
 Frog    13 ALFMHWHISAIFCVLC-------DSKFVNAIEY----------CGWDETFRGS--PERSF----- 53

  Fly   245 NKHFESNWIYWLAPL----SSSAITAYAYKVVF 273
             |.||::.:.:...|    ..||:...|.:.:|
 Frog    54 -KTFEADGVTYFTTLLLGKDGSALYVGAQEALF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 22/95 (23%)
sema4bXP_031755080.1 Sema 55..520 CDD:417757 7/31 (23%)
PSI 521..564 CDD:214655
Ig 594..669 CDD:416386
Ig strand B 602..610 CDD:409353
Ig strand C 616..622 CDD:409353
Ig strand C' 624..627 CDD:409353
Ig strand D 631..635 CDD:409353
Ig strand E 637..643 CDD:409353
Ig strand F 649..658 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.