DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Eglp4 and sema4b

DIOPT Version :9

Sequence 1:	NP_001261154.1	Gene:	Eglp4 / 37739	FlyBaseID:	FBgn0034885	Length:	297	Species:	Drosophila melanogaster
Sequence 2:	XP_031755080.1	Gene:	sema4b / 100489037	XenbaseID:	XB-GENE-922109	Length:	850	Species:	Xenopus tropicalis

Alignment Length:	98	Identity:	23/98 - (23%)
Similarity:	40/98 - (40%)	Gaps:	29/98 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   180 ALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALW 244
            ||.:.:.|::|..::|       :|||.:::..          |.......||  |.|||
Frog    13 ALFMHWHISAIFCVLC-------DSKFVNAIEY----------CGWDETFRGS--PERSF----- 53

  Fly   245 NKHFESNWIYWLAPL----SSSAITAYAYKVVF 273
             |.||::.:.:...|    ..||:...|.:.:|
Frog    54 -KTFEADGVTYFTTLLLGKDGSALYVGAQEALF 85

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Eglp4	NP_001261154.1	MIP	59..272	CDD:294134	22/95 (23%)
sema4b	XP_031755080.1	Sema	55..520	CDD:417757	7/31 (23%)
		PSI	521..564	CDD:214655
		Ig	594..669	CDD:416386
		Ig strand B	602..610	CDD:409353
		Ig strand C	616..622	CDD:409353
		Ig strand C'	624..627	CDD:409353
		Ig strand D	631..635	CDD:409353
		Ig strand E	637..643	CDD:409353
		Ig strand F	649..658	CDD:409353
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0580
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000054
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900