DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and XB5993457

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001135583.1 Gene:XB5993457 / 100216133 XenbaseID:XB-GENE-5993458 Length:268 Species:Xenopus tropicalis


Alignment Length:256 Identity:77/256 - (30%)
Similarity:126/256 - (49%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLG--------ELIGTGILVFL---GCMGCVKTDLFPN-NHLQIVLNFGFAVLIAIQCFGCV 109
            ::||.|        .:.|..:.|||   ..:|.......|. :...|.|.|||::.|.|.|||.:
 Frog     1 MTAFKGIWTRQFWTSMAGEFLAVFLFLVVSLGSTAGITIPGPSETHIALCFGFSIAILIHCFGHI 65

  Fly   110 SGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTS 174
            ..|:|||||.:|....:.::......|...|.|.|..|.|::.::.|:....||    :|..|.:
 Frog    66 CEAYLNPAVAMAMICTKKISAAKGIFYIIIQCLAAIAGAGVVALITPNDKWPVG----ITKEHET 126

  Fly   175 VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSF 239
            ::.||||.:|.:||..||.......|.:.|.....:.:..||::......|..:||.|||||||.
 Frog   127 ISHGQALLVETLITFQLVFTIFASCDKKRSDIKVPIPLIIGLSVTIGHLFAIKYTGASMNPARSL 191

  Fly   240 APALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRRE-VVEAEITSNEKLRQLED--VQLS 297
            ..::...|:|::||||:.|:....:.::.|:.:|..: .|:..:.:|...:|.||  |||:
 Frog   192 GTSVVFNHWENHWIYWIGPMMGGILASFVYEYLFCPDPEVKLRLQANFTRQQNEDESVQLT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/224 (30%)
XB5993457NP_001135583.1 MIP 12..221 CDD:350945 64/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.