DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp10b

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005159449.1 Gene:aqp10b / 100034395 ZFINID:ZDB-GENE-060503-57 Length:309 Species:Danio rerio


Alignment Length:230 Identity:58/230 - (25%)
Similarity:97/230 - (42%) Gaps:25/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPN---NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAA 122
            |.|..|..:|:..||....:.....|   .:|.|.|.|.......|.....||||||||||:|:.
Zfish    19 LAEFFGVYVLILFGCGSVAQVTTSQNTKGEYLSINLGFALGTTFGIYIAKGVSGAHLNPAVSVSL 83

  Fly   123 YIYEMVT-LRMAFAYFAAQMLGAFIG--------YGLLMVL----LPSPTLTVGAGLCVTLPHTS 174
            .:....: .|:.| |..:|:.|||:.        |..:|..    |.....|..||:..|.|...
Zfish    84 CVLGRFSWTRLPF-YVCSQLFGAFLAAATVALQYYDAIMDFTGGHLTVSGATATAGIFSTYPADY 147

  Fly   175 VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSV-GIRFGLAIACLACAAGPFTGGSMNPARS 238
            ::....:..:.:.|:.|::....:.|..|:.....: .:..|.|:..:..:.|..:|.::||||.
Zfish   148 LSLWGGVVDQIIGTAALLVCVLALGDAHNTPAPAGLEPVLVGAAVLVIGISMGSNSGYAINPARD 212

  Fly   239 FAPAL------W-NKHFESNWIYWLAPLSSSAITA 266
            |.|.|      | ::.|.:...:|..|:..:.:.|
Zfish   213 FGPRLFSYIAGWGDEVFRAGHGWWWVPIIVTCVGA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 58/230 (25%)
aqp10bXP_005159449.1 MIP 5..247 CDD:294134 57/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.