DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP10

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011508406.1 Gene:AQP10 / 89872 HGNCID:16029 Length:302 Species:Homo sapiens


Alignment Length:254 Identity:76/254 - (29%)
Similarity:114/254 - (44%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFIACM--GCV-------ETPLFQNSHFRSGLTFGLAILIAIQCFGSV 79
            |..:|.|.|      |||.:..:  |.|       ||   :.:.|...|...||:.|||...|:|
Human    22 RQCLAEFLG------VFVLMQLLTQGAVAQAVTSGET---KGNFFTMFLAGSLAVTIAIYVGGNV 77

  Fly    80 SGAHLNPAITLAAWLYGAIGWIRAIAYFVAQ------AAGA--LIGYGLLVAVLPGN-SIKGVDN 135
            ||||||||.:||..:.|.:.|::...|.:.|      |:||  ::.:..|.....|| ::.|...
Human    78 SGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKE 142

  Fly   136 PSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLILTAG 199
            .:.:..|..||.:|:..|...:.|.|..|::...::.|.||..:...: ||..|:.:..|.|:.|
Human   143 TASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMG 207

  Fly   200 LFTGASMNPTRSLGP------AVW--------NDSWAHHWIYWVGPLVAGAVTSLIYRM 244
            ...|..:||.|.|||      |.|        |..|   |:..|.|||...|.:..|::
Human   208 ANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWW---WVPVVAPLVGATVGTATYQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 74/246 (30%)
AQP10XP_011508406.1 MIP 13..266 CDD:294134 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.