DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQY1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_015518.1 Gene:AQY1 / 856322 SGDID:S000006396 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:71/246 - (28%)
Similarity:117/246 - (47%) Gaps:34/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ARWRLEGHQRSAIACFFGELAATAVFVFIACMGC---------VETPLFQNSH----FRSGLTFG 66
            :|..|..|..:|:    ||...|.:|::.|.:.|         |..|  ..||    ....:.||
Yeast    41 SRDTLRDHFIAAV----GEFCGTFMFLWCAYVICNVANHDVALVAAP--DGSHPGQLIMIAIGFG 99

  Fly    67 LAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIK 131
            .:::.:|.||..|||..||||::|:..|..|:...|.:..:|:|....:...|...|:.||..: 
Yeast   100 FSVMFSIWCFAGVSGGALNPAMSLSLCLARAVSPTRCVVMWVSQIVAGMAAGGAASAMTPGEVL- 163

  Fly   132 GVDNPSGVCVTILAPGISVLQGVFIEFLITC--CLVMVACSVWDPRNAKLQDSVPVRFGLTVSCL 194
             ..|..|:       |.|..:|:|:|...|.  ||.::..:| :.|......::|:...|.::.:
Yeast   164 -FANSLGL-------GCSRTRGLFLEMFGTAILCLTVLMTAV-EKRETNFMAALPIGISLFIAHV 219

  Fly   195 ILTAGLFTGASMNPTRSLGPAVWNDSWAH-HWIYWVGPLVAGAVTSLIYRM 244
            .|||  :||..:||.||||.||....:.| |||||:|.|:...:...::::
Yeast   220 ALTA--YTGTGVNPARSLGAAVAARYFPHYHWIYWIGTLLGSILAWSVWQL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 67/229 (29%)
AQY1NP_015518.1 MIP 54..266 CDD:273306 67/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.