DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and FPS1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_013057.1 Gene:FPS1 / 850683 SGDID:S000003966 Length:669 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:57/210 - (27%)
Similarity:92/210 - (43%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTFGLAILIAIQCFG--SVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVL 125
            |.:..|:::...|.|  ::|||||||:||||..:|......:...||..|..||..| .|::.:.
Yeast   328 LGWAAAVVMGYFCAGGSAISGAHLNPSITLANLVYRGFPLKKVPYYFAGQLIGAFTG-ALILFIW 391

  Fly   126 PGNSIKGV-------DNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSV 183
            ....::..       ::.:|:......|.:|..:..|.|||....|.....::.||......|..
Yeast   392 YKRVLQEAYSDWWMNESVAGMFCVFPKPYLSSGRQFFSEFLCGAMLQAGTFALTDPYTCLSSDVF 456

  Fly   184 PVRFGLTVSCLILTAGLFTGASMNPTRSLGP-----AVWNDS---WAHH----WIYWVGPLVAGA 236
            |:...:.:..:..:....||.:||..|.|||     ||..|.   |.||    |:..|||.:...
Yeast   457 PLMMFILIFIINASMAYQTGTAMNLARDLGPRLALYAVGFDHKMLWVHHHHFFWVPMVGPFIGAL 521

  Fly   237 VTSLIYRMA-FKGDE 250
            :..|:|.:. ::|.|
Yeast   522 MGGLVYDVCIYQGHE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 55/201 (27%)
FPS1NP_013057.1 MIP 244..527 CDD:395174 54/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.869916 Normalized mean entropy S1906
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
76.590

Return to query results.
Submit another query.