DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and YLL053C

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_013047.1 Gene:YLL053C / 850673 SGDID:S000003976 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:42/142 - (29%)
Similarity:69/142 - (48%) Gaps:16/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITC--CLVMVA 168
            :|....||...| |...|:.||..:  ..|..|:       |.|..:|:|:|...|.  ||.::.
Yeast     2 WFPQIIAGMAAG-GAASAMTPGKVL--FTNALGL-------GCSRSRGLFLEMFGTAVLCLTVLM 56

  Fly   169 CSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAH-HWIYWVGPL 232
            .:| :.|......::|:...|.::.:.||.  :||..:||.||||.||....:.| |||||:.||
Yeast    57 TAV-EKRETNFMAALPIGISLFMAHMALTG--YTGTGVNPARSLGAAVAARYFPHYHWIYWISPL 118

  Fly   233 VAGAVTSLIYRM 244
            :...:...::::
Yeast   119 LGAFLAWSVWQL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 42/140 (30%)
YLL053CNP_013047.1 MIP <1..133 CDD:412216 42/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.