DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AT1G52180

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_175629.1 Gene:AT1G52180 / 841648 AraportID:AT1G52180 Length:124 Species:Arabidopsis thaliana


Alignment Length:96 Identity:29/96 - (30%)
Similarity:46/96 - (47%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVSC 193
            ::.|...:.:.:..:|..:...|.|.:|.:||..|| .|..:..|..|..|....|:...|.|..
plant    29 LEAVPTSNAIPIHSVAVRVGSTQRVVMEIIITFALVYTVYATAIDSNNGTLGTIAPLAIRLIVGA 93

  Fly   194 LILTAGLFTGASMNPTRSLGPAVWNDSWAHH 224
            .||.||.|:|..|||.||.|.::...:::.|
plant    94 NILAAGPFSGGPMNPGRSFGSSLAVGNFSGH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 29/96 (30%)
AT1G52180NP_175629.1 MIP <29..122 CDD:294134 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.