DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and NIP3;1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_174472.2 Gene:NIP3;1 / 840079 AraportID:AT1G31885 Length:323 Species:Arabidopsis thaliana


Alignment Length:243 Identity:69/243 - (28%)
Similarity:100/243 - (41%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSG--LTFGLAILIAIQCFGSVSGAHLNPA 87
            |.:....||...|...:|..|...|....:.......|  |.:||.:.:.|...|.|||||.|||
plant    40 SFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLVVTVMIYSIGHVSGAHFNPA 104

  Fly    88 ITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLL---------VAVLPGNSIKGVDNPSGVCVTI 143
            :::|........:.:...|..||..|:.:...:|         |..|.|:...|.          
plant   105 VSIAFASSKKFPFNQVPGYIAAQLLGSTLAAAVLRLVFHLDDDVCSLKGDVYVGT---------- 159

  Fly   144 LAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNP 208
             .|..|......:||:.|..|:.|..:|...:.| ......:..|.|:...||.:|..:||||||
plant   160 -YPSNSNTTSFVMEFIATFNLMFVISAVATDKRA-TGSFAGIAIGATIVLDILFSGPISGASMNP 222

  Fly   209 TRSLGPA-VWNDSWAHHWIYWVGPLV---AGAVTSLIYRMAFKGDEEI 252
            .|||||| :|. .:...|:|.|.|::   :||.|..:.|...|...||
plant   223 ARSLGPALIWG-CYKDLWLYIVSPVIGALSGAWTYGLLRSTKKSYSEI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 64/228 (28%)
NIP3;1NP_174472.2 MIP 37..271 CDD:294134 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.