DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP1C

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_171668.1 Gene:PIP1C / 839235 AraportID:AT1G01620 Length:286 Species:Arabidopsis thaliana


Alignment Length:267 Identity:77/267 - (28%)
Similarity:115/267 - (43%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQQKQKSQESNPNARWRLEGH------QRSAIACFFGELAATAVFVFI---ACMGCVETPLFQNS 57
            |.|..|..:..|.|.:...|.      .|:.||    |..||.:|::|   ..||....|....|
plant    24 SAQTDKDYKEPPPAPFFEPGELSSWSFYRAGIA----EFIATFLFLYITVLTVMGVKRAPNMCAS 84

  Fly    58 HFRSGL--TFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGL 120
            ....|:  .||..|...:.|...:||.|:|||:|...:|...:...||:.|.|.|..||:.|.|:
plant    85 VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGV 149

  Fly   121 LVAVLPGNSIKGVDNP---SGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDS 182
            :....|        ||   .|.....:|.|.:...|:..|.:.|..||....|..|.:.:.....
plant   150 VKGFQP--------NPYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSH 206

  Fly   183 VPVRFGLTVSCLILTAGL----FTGASMNPTRSLGPA-VWN--DSWAHHWIYWVGPLVAGAVTSL 240
            ||:...|.:...:....|    .||..:||.||||.| ::|  .:|..|||:||||.:..|:.:|
plant   207 VPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAAL 271

  Fly   241 IYRMAFK 247
            .:::..:
plant   272 YHQLVIR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 68/228 (30%)
PIP1CNP_171668.1 MIP 44..273 CDD:395174 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.