DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and NIP4;2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001330234.1 Gene:NIP4;2 / 833760 AraportID:AT5G37820 Length:319 Species:Arabidopsis thaliana


Alignment Length:251 Identity:69/251 - (27%)
Similarity:108/251 - (43%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AIAC----FFGELAATAVFVFIACMGCVETPLFQNSHFRSGL--TFGLAILIAIQCFGSVSGAHL 84
            :|.|    ...|:..|...:|..|...|...|:..:....|:  |:||.:::.|...|.:||||.
plant    73 SIVCLTQKLIAEMIGTYFIIFSGCGVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHF 137

  Fly    85 NPAITLAAWLYGAIGWIRAIAYFVAQAAGALIG---YGLLVAVLPGNSIKGVDNPSGVCVTILAP 146
            |||:|:...::....|.:...|..||..|:|:.   ..|:..|.| .:..|.           .|
plant   138 NPAVTVTFAVFRRFPWYQVPLYIGAQLTGSLLASLTLRLMFNVTP-KAFFGT-----------TP 190

  Fly   147 GISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRS 211
            ..|..|.:..|.:|:..|:.|...|.....| ..:...:..|:|:...:..||..:||||||.||
plant   191 TDSSGQALVAEIIISFLLMFVISGVATDSRA-TGELAGIAVGMTIILNVFVAGPISGASMNPARS 254

  Fly   212 LGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYR-MAFKGDEEIDLRTSDAKIRMIGE 266
            ||||:....:...|:|.|||.|.......:|. |.|......:|..|.:.:|.:.:
plant   255 LGPAIVMGRYKGIWVYIVGPFVGIFAGGFVYNFMRFTDKPLRELTKSASFLRSVAQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 62/219 (28%)
NIP4;2NP_001330234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.