DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP3

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001190920.1 Gene:PIP3 / 829662 AraportID:AT4G35100 Length:280 Species:Arabidopsis thaliana


Alignment Length:240 Identity:72/240 - (30%)
Similarity:110/240 - (45%) Gaps:40/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRS-------GL-----TFGLAILIAIQCF 76
            |:.||    |..||.:|:::.    |.|.:   .|.:.       ||     .||..|.:.:.|.
plant    38 RALIA----EFIATLLFLYVT----VATVI---GHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCT 91

  Fly    77 GSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVL--PGNSIKGVDNPSGV 139
            ..:||.|:|||:|...:|...:..:||:.|.:||..||:.|.|.:.|.:  |.|::.|..|    
plant    92 AGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGAN---- 152

  Fly   140 CVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGL---- 200
               .:|.|.|....:..|.:.|..||....|..||:.:.....:||...|.:...:....|    
plant   153 ---TVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIP 214

  Fly   201 FTGASMNPTRSLGPAV-WND--SWAHHWIYWVGPLVAGAVTSLIY 242
            .||..:||.||.|.|| :|:  :|...||:||||.: ||:.:..|
plant   215 ITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFL-GALAAAAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 69/234 (29%)
PIP3NP_001190920.1 MIP 30..259 CDD:395174 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.