DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP1;5

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_194071.1 Gene:PIP1;5 / 828439 AraportID:AT4G23400 Length:287 Species:Arabidopsis thaliana


Alignment Length:264 Identity:74/264 - (28%)
Similarity:118/264 - (44%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQQKQKSQESNPNARWRLEGH------QRSAIACFFGELAATAVFVFI---ACMGCVETPLFQNS 57
            :|.:.|..:..|.|.:...|.      .|:.||    |..||.:|:::   ..||....|....|
plant    25 AQTESKDYKEPPPAPFFEPGELKSWSFYRAGIA----EFIATFLFLYVTVLTVMGVKRAPNMCAS 85

  Fly    58 HFRSGL--TFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGL 120
            ....|:  .||..|...:.|...:||.|:|||:|...:|...:...||:.|.|.|..||:.|.|:
plant    86 VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIVMQCLGAICGAGV 150

  Fly   121 LVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPV 185
            :....|     |:...:|....::|.|.:...|:..|.:.|..||....|..|.:.:.....||:
plant   151 VKGFQP-----GLYQTNGGGANVVAHGYTKGSGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPI 210

  Fly   186 RFGLTVSCLILTAGL----FTGASMNPTRSLGPA-VWN--DSWAHHWIYWVGPLVAGAVTSLIYR 243
            ...|.:...:....|    .||..:||.||||.| ::|  .:|..|||:||||.:..|:.:|.::
plant   211 LAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQ 275

  Fly   244 MAFK 247
            :..:
plant   276 IVIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 66/225 (29%)
PIP1;5NP_194071.1 MIP 45..274 CDD:395174 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.