DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and TIP1;3

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_192056.1 Gene:TIP1;3 / 828051 AraportID:AT4G01470 Length:252 Species:Arabidopsis thaliana


Alignment Length:251 Identity:80/251 - (31%)
Similarity:118/251 - (47%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFG------------------ 66
            |..:..||...|.|..:..:||| |..|             ||:.:|                  
plant    13 EASRPDAIRAAFAEFFSMVIFVF-AGQG-------------SGMAYGKLTGDGPATPAGLVAASL 63

  Fly    67 ---LAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGN 128
               .|:.:|:....:|||.|:|||:|..|::.|.|..:|||.|::||..||::.. ||:.|..| 
plant    64 SHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVAC-LLLKVSTG- 126

  Fly   129 SIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVS 192
               |::    .....|:.|::....|..|.::|..|| .|..:..||:...:....|:..||.|.
plant   127 ---GME----TAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVG 184

  Fly   193 CLILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKG 248
            ..||..|.|.||||||..|.||||.:..|.:||:|||||.:..|:.:::|...|.|
plant   185 ANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 75/235 (32%)
TIP1;3NP_192056.1 PLN00027 1..252 CDD:177664 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.