DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP1;4

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_567178.1 Gene:PIP1;4 / 827956 AraportID:AT4G00430 Length:287 Species:Arabidopsis thaliana


Alignment Length:238 Identity:70/238 - (29%)
Similarity:108/238 - (45%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFI---ACMGCVETPLFQNSHFRSGL--TFGLAILIAIQCFGSVSGAH 83
            |:.||    |..||.:|::|   ..||....|....|....|:  .||..|...:.|...:||.|
plant    53 RAGIA----EFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGH 113

  Fly    84 LNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAV--LPGNSIKGVDNPSGVCVTILAP 146
            :|||:|...:|...:...||:.|.:.|..||:.|.|::...  .|..::.|..|       .:|.
plant   114 INPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGAN-------TVAH 171

  Fly   147 GISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGL----FTGASMN 207
            |.:...|:..|.:.|..||....|..|.:.:.....||:...|.:...:....|    .||..:|
plant   172 GYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGIN 236

  Fly   208 PTRSLGPA-VWN--DSWAHHWIYWVGPLVAGAVTSLIYRMAFK 247
            |.||||.| ::|  .||..|||:||||.:..|:.:|.:::..:
plant   237 PARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 67/227 (30%)
PIP1;4NP_567178.1 MIP 45..274 CDD:395174 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.