DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and NLM1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_567572.1 Gene:NLM1 / 827641 AraportID:AT4G19030 Length:296 Species:Arabidopsis thaliana


Alignment Length:248 Identity:76/248 - (30%)
Similarity:112/248 - (45%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IACFFGELAATAVFVFIACMGCVETPLFQNSHFRS----GLTFGLAILIAIQCFGSVSGAHLNPA 87
            ||.|.|    |...||..|...|..  .||.:..:    .:.:||.|::.|...|.:||||:|||
plant    58 IAEFLG----TYFLVFTGCASVVVN--MQNDNVVTLPGIAIVWGLTIMVLIYSLGHISGAHINPA 116

  Fly    88 ITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVC-----VTI-LAP 146
            :|:|....|.....:..||.::|    :||..|..|.|  ..:.|:|:  .||     |.| .:|
plant   117 VTIAFASCGRFPLKQVPAYVISQ----VIGSTLAAATL--RLLFGLDH--DVCSGKHDVFIGSSP 173

  Fly   147 GISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRS 211
            ..|.||...:||::|..|:.:...| ...|..:.:...:..|.||...:|.|...:.|||||.||
plant   174 VGSDLQAFTMEFIVTFYLMFIISGV-ATDNRAIGELAGLAIGSTVLLNVLIAAPVSSASMNPGRS 237

  Fly   212 LGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSDAKIRMI 264
            ||||:....:...|||.|.|.:.....:.:|.         .:|.:|..:|.|
plant   238 LGPALVYGCYKGIWIYLVAPTLGAIAGAWVYN---------TVRYTDKPLREI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 70/223 (31%)
NLM1NP_567572.1 PLN00184 1..296 CDD:177778 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.