DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and NIP1;2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_193626.1 Gene:NIP1;2 / 827626 AraportID:AT4G18910 Length:294 Species:Arabidopsis thaliana


Alignment Length:244 Identity:77/244 - (31%)
Similarity:112/244 - (45%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMG-CVETPLFQNSHFRS------GLTFGLAILIAIQCFGSVSGAHLNPAITL 90
            |:..|...:|..|.. .|.|     .|.::      .:.:||.:::.:...|.:||||.|||:|:
plant    57 EVLGTYFLIFAGCAAVAVNT-----QHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTI 116

  Fly    91 AAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNP--SG---VCVTILAPGISV 150
            |....|.....:..||.::|    :||..|..|.|  ..:.|:|..  ||   |.|..|..| |.
plant   117 AFASCGRFPLKQVPAYVISQ----VIGSTLAAATL--RLLFGLDQDVCSGKHDVFVGTLPSG-SN 174

  Fly   151 LQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPA 215
            ||...|||:||..|:.|...| ...|..:.:...:..|.||...::.||..:||||||.||||||
plant   175 LQSFVIEFIITFYLMFVISGV-ATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPA 238

  Fly   216 VWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSDAKIRMI 264
            :....:...|||.|.|:|.....:.:|.|         :|.:|..:|.|
plant   239 MVYSCYRGLWIYIVSPIVGAVSGAWVYNM---------VRYTDKPLREI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 72/222 (32%)
NIP1;2NP_193626.1 PLN00184 1..293 CDD:177778 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.