DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and TIP2;2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_193465.1 Gene:TIP2;2 / 827446 AraportID:AT4G17340 Length:250 Species:Arabidopsis thaliana


Alignment Length:247 Identity:86/247 - (34%)
Similarity:120/247 - (48%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTF------------GL---------A 68
            :::..:..|..||.:||| |.:|             |.|.|            ||         |
plant    16 ASLKAYLSEFIATLLFVF-AGVG-------------SALAFAKLTSDAALDPAGLVAVAVAHAFA 66

  Fly    69 ILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGV 133
            :.:.:....::||.|||||:||...:.|.|..|....|::||..|:::...|||.|..|.|:   
plant    67 LFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESV--- 128

  Fly   134 DNPS-GVCVTILAPGISVLQGVFIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVSCLIL 196
              |: ||     |.|:..::||.:|.::|..|| .|..:..||:...|....|:..|..|...||
plant   129 --PTHGV-----AAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANIL 186

  Fly   197 TAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKG 248
            .||.|:|.||||.||.||||.:..::..|||||||||.||:..|||...|.|
plant   187 AAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 84/236 (36%)
TIP2;2NP_193465.1 PLN00166 1..250 CDD:165733 86/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.