DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and NIP5;1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_192776.1 Gene:NIP5;1 / 826630 AraportID:AT4G10380 Length:304 Species:Arabidopsis thaliana


Alignment Length:215 Identity:67/215 - (31%)
Similarity:102/215 - (47%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVETPLFQNSHFRSG--LTFGLAILIAIQCFGSVSGAHLNPAITLAAWLY 95
            |...|.:.:|.|..|.:....:..:....|  ...|||::|.|...|.:|||||||::|:|....
plant    83 EFVGTFILIFTATAGPIVNQKYDGAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAAL 147

  Fly    96 GAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNP---SGVCVTILAPGISVLQGVFIE 157
            ....|....||..||.:         .::....::|||.:|   .||.:    |.:|:.|...:|
plant   148 RHFPWAHVPAYIAAQVS---------ASICASFALKGVFHPFMSGGVTI----PSVSLGQAFALE 199

  Fly   158 FLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWA 222
            |:||..|:.|..:|.....| :.:...:..|.||...||.||..||.||||.|:|||||.:.::.
plant   200 FIITFILLFVVTAVATDTRA-VGELAGIAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYR 263

  Fly   223 HHWIYWVGPLVAGAVTSLIY 242
            ..|:|.|.|.:.....:.:|
plant   264 SLWVYLVAPTLGAISGAAVY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 67/215 (31%)
NIP5;1NP_192776.1 PLN00026 29..304 CDD:177663 67/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.