DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP1A

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001078323.1 Gene:PIP1A / 825316 AraportID:AT3G61430 Length:286 Species:Arabidopsis thaliana


Alignment Length:261 Identity:83/261 - (31%)
Similarity:116/261 - (44%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQQKQKSQESNPNARWRLEGH------QRSAIACFFGELAATAVFVFI---ACMGCVETPLFQNS 57
            |.|..|..:..|.|.:...|.      .|:.||    |..||.:|::|   ..||...:|....|
plant    24 SAQSDKDYKEPPPAPFFEPGELSSWSFWRAGIA----EFIATFLFLYITVLTVMGVKRSPNMCAS 84

  Fly    58 HFRSGL--TFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGL 120
            ....|:  .||..|...:.|...:||.|:|||:|...:|...:...||:.|.|.|..||:.|.| 
plant    85 VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALYYIVMQCLGAICGAG- 148

  Fly   121 LVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWD-PRNAKLQDS-- 182
               |:.|...|......|...|: |.|.:...|:..|.:.|..||....|..| .|||:  ||  
plant   149 ---VVKGFQPKQYQALGGGANTV-AHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRNAR--DSHV 207

  Fly   183 ---VPVRFGLTVSCLILTAGLFTGASMNPTRSLGPA-VWN--DSWAHHWIYWVGPLVAGAVTSLI 241
               .|:..|..|..:.|.....||..:||.||||.| ::|  .||..||::||||.:..|:.:|.
plant   208 PILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWDDHWVFWVGPFIGAALAALY 272

  Fly   242 Y 242
            :
plant   273 H 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 74/227 (33%)
PIP1ANP_001078323.1 MIP 44..273 CDD:395174 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.