DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP2;5

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_191042.1 Gene:PIP2;5 / 824647 AraportID:AT3G54820 Length:286 Species:Arabidopsis thaliana


Alignment Length:242 Identity:73/242 - (30%)
Similarity:110/242 - (45%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFIACMGCV----ETPLFQNSHFRSGL-------TFGLAILIAIQCFG 77
            |:.||    |..||.:|:::..|..:    :|....|....:|:       .||..|.|.:.|..
plant    38 RALIA----EFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTA 98

  Fly    78 SVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVT 142
            .:||.|:|||:|....|...:..:||:.|.|||..||:.|..|:.|.......:.....:|    
plant    99 GISGGHINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANG---- 159

  Fly   143 ILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGL----FTG 203
             |:.|.|:..||..|.:.|..||....|..||:.:.....|||...|.:...:....|    .||
plant   160 -LSDGYSIGTGVAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITG 223

  Fly   204 ASMNPTRSLGPA-VWN--DSWAHHWIYWVGPLVAGAVTSLIYRMAFK 247
            ..:||.||||.| ::|  .:|.||||:||||....|:.:..::...:
plant   224 TGINPARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 70/231 (30%)
PIP2;5NP_191042.1 MIP 30..265 CDD:395174 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.