DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and TIP2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_189283.1 Gene:TIP2 / 822259 AraportID:AT3G26520 Length:253 Species:Arabidopsis thaliana


Alignment Length:259 Identity:86/259 - (33%)
Similarity:122/259 - (47%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPNARWRLEGHQRSAIACFFGELAATAVFVFIAC-MGCVETPLFQN-SHFRSGL-------TFGL 67
            :|||       .|:|:|    |..:|.:|||... .|.....:..| :...|||       .|||
plant    17 HPNA-------LRAALA----EFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGL 70

  Fly    68 AILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKG 132
              .:|:....::||.|:|||:|....|.|.|..:|.|.|::||..|::....||.....|..|..
plant    71 --FVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPA 133

  Fly   133 VDNPSGVCVTILAPGISVLQGVFIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVSCLIL 196
            ..         |:.|:..|..:..|.::|..|| .|..:..||:|..|....|:..|..|...||
plant   134 FG---------LSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANIL 189

  Fly   197 TAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEI--DLRTSD 258
            ..|.|:||||||..:.||||.:.:|.:||:||.|||:.|.:..:||...|. ||..  .|.|:|
plant   190 AGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFI-DENAHEQLPTTD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 74/223 (33%)
TIP2NP_189283.1 PLN00027 1..253 CDD:177664 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.