DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and DELTA-TIP

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_188245.1 Gene:DELTA-TIP / 820870 AraportID:AT3G16240 Length:250 Species:Arabidopsis thaliana


Alignment Length:252 Identity:80/252 - (31%)
Similarity:121/252 - (48%) Gaps:36/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAIACFFGELAATAVFVF-----------IACMGCVETPLFQNSHFRSGLT-----FGLAILIAI 73
            :::..:..|..:|.:|||           :.....::||         ||.     .|.|:.:|:
plant    16 ASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTP---------GLVAIAVCHGFALFVAV 71

  Fly    74 QCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSG 138
            ....::||.|:|||:|....:.|.|..|..:.|::||..|:.....||..|..|.::.       
plant    72 AIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVTGGLAVP------- 129

  Fly   139 VCVTILAPGISVLQGVFIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFT 202
              ...:|.|:..::||.:|.:||..|| .|..:..||:...|....|:..||.|...||.||.|:
plant   130 --THSVAAGLGSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGANILAAGPFS 192

  Fly   203 GASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKG-DEEIDLRTSD 258
            |.||||.||.||||....::.||:||||||:.|.:..|||...|.| .|.:.|.::|
plant   193 GGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVFMGSSEHVPLASAD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 75/230 (33%)
DELTA-TIPNP_188245.1 MIP 1..244 CDD:412216 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.