DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP2E

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_181434.1 Gene:PIP2E / 818487 AraportID:AT2G39010 Length:289 Species:Arabidopsis thaliana


Alignment Length:268 Identity:81/268 - (30%)
Similarity:118/268 - (44%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACM----------------GCVETPLFQ 55
            |:.|.....:|   ...|:.||    |..||.:|:::..:                .|....|. 
plant    24 KTFEVRELKKW---SFYRAVIA----EFIATLLFLYVTVLTVIGFKSQTDINAGGGACASVGLL- 80

  Fly    56 NSHFRSGLT--FGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGY 118
                  |::  ||..|.|.:.|...:||.|:|||:|...:|...:..:||::|.|||..||..|.
plant    81 ------GISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGV 139

  Fly   119 GLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDP-RNAKLQDS 182
            | ||.|......    |..|....:|:.|.:|..||..|.:.|..||....|..|| |||:  ||
plant   140 G-LVKVFQSTYY----NRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNAR--DS 197

  Fly   183 -----VPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAV-WND--SWAHHWIYWVGPLVAGAVTS 239
                 .|:..|.:|..:.|.....||..:||.||.|.|| :|:  :|...||:||||.|..|:.:
plant   198 HIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAA 262

  Fly   240 LIYRMAFK 247
            ..::...:
plant   263 FYHQFVLR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 75/240 (31%)
PIP2ENP_181434.1 MIP 30..265 CDD:395174 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.