DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and RD28

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_181255.1 Gene:RD28 / 818294 AraportID:AT2G37180 Length:285 Species:Arabidopsis thaliana


Alignment Length:267 Identity:80/267 - (29%)
Similarity:117/267 - (43%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSG-------------LTFGL 67
            :|.|   .|:.||    |..||.:|:::..:..:...:  .|..::|             ..||.
plant    32 KWSL---YRAVIA----EFVATLLFLYVTVLTVIGYKI--QSDTKAGGVDCGGVGILGIAWAFGG 87

  Fly    68 AILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKG 132
            .|.|.:.|...:||.|:|||:|...:|...:..|||:.|.|||..||:.|.|.:.|....:.:. 
plant    88 MIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVN- 151

  Fly   133 VDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDP-RNAKLQDS-----VPVRFGLTV 191
                .|.....||.|.:...|:..|.:.|..||....|..|| |||:  ||     .|:..|..|
plant   152 ----YGGGANFLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNAR--DSHVPVLAPLPIGFAV 210

  Fly   192 SCLILTAGLFTGASMNPTRSLGPAV-WNDS--WAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEID 253
            ..:.|.....||..:||.||.|.|| :|.|  |..|||:||||.:...:.:..::..        
plant   211 FMVHLATIPITGTGINPARSFGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFV-------- 267

  Fly   254 LRTSDAK 260
            ||.|.:|
plant   268 LRASGSK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 71/235 (30%)
RD28NP_181255.1 MIP 29..264 CDD:395174 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.