DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and PIP2B

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001323849.1 Gene:PIP2B / 818293 AraportID:AT2G37170 Length:328 Species:Arabidopsis thaliana


Alignment Length:267 Identity:82/267 - (30%)
Similarity:117/267 - (43%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSG-------------LTFGL 67
            :|.|   .|:.||    |..||.:|::|..:..:...:  .|..::|             ..||.
plant    75 KWSL---YRAVIA----EFVATLLFLYITVLTVIGYKI--QSDTKAGGVDCGGVGILGIAWAFGG 130

  Fly    68 AILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKG 132
            .|.|.:.|...:||.|:|||:|...:|...:..|||:.|.|||..||:.|.|.:.|..     ..
plant   131 MIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQ-----SS 190

  Fly   133 VDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDP-RNAKLQDS-----VPVRFGLTV 191
            ..:..|.....||.|.:...|:..|.:.|..||....|..|| |||:  ||     .|:..|..|
plant   191 YYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNAR--DSHVPVLAPLPIGFAV 253

  Fly   192 SCLILTAGLFTGASMNPTRSLGPAV-WNDS--WAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEID 253
            ..:.|.....||..:||.||.|.|| :|.|  |..|||:||||.:..|:.:..::..        
plant   254 FMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFV-------- 310

  Fly   254 LRTSDAK 260
            ||.|.:|
plant   311 LRASGSK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 73/235 (31%)
PIP2BNP_001323849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.