DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and GAMMA-TIP

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_181221.1 Gene:GAMMA-TIP / 818255 AraportID:AT2G36830 Length:251 Species:Arabidopsis thaliana


Alignment Length:249 Identity:81/249 - (32%)
Similarity:120/249 - (48%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGHQRSAIACFFGELAATAVFVFIAC-MGCVETPLFQN-SHFRSGL-------TFGLAILIAIQC 75
            |..:..|:.....|..:|.:||.... .|.....|.:| :...|||       .|||  .:|:..
plant    13 EATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGL--FVAVSV 75

  Fly    76 FGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVC 140
            ..::||.|:|||:|..|::.|.|..:|.|.|::||..|:::...:|.....|.::....      
plant    76 GANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFG------ 134

  Fly   141 VTILAPGISVLQGVFIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGA 204
               |:.|:.||.....|.::|..|| .|..:..||:|..|....|:..|..|...||..|.|:||
plant   135 ---LSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGA 196

  Fly   205 SMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSD 258
            ||||..:.||||.:.:|.:||:||.||||.|.:..|||.:.|.......|.|:|
plant   197 SMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTTD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 75/223 (34%)
GAMMA-TIPNP_181221.1 PLN00027 1..251 CDD:177664 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.