DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and NIP2;1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_180986.1 Gene:NIP2;1 / 818002 AraportID:AT2G34390 Length:288 Species:Arabidopsis thaliana


Alignment Length:227 Identity:68/227 - (29%)
Similarity:106/227 - (46%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVETPLFQNSHFRS----GLTFGLAILIAIQCFGSVSGAHLNPAITLAAW 93
            ||..|...:|..|.......  |::|..:    .:.:|:.|::.:.|.|.:| ||.|||:|||..
plant    53 ELVGTYYLIFAGCAAIAVNA--QHNHVVTLVGIAVVWGIVIMVLVYCLGHLS-AHFNPAVTLALA 114

  Fly    94 LYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNS---IKGVD-----NPSGVCVTILAPGISV 150
            ........:..||...|..|:.:....|..:...|:   .|..|     :|||          |.
plant   115 SSQRFPLNQVPAYITVQVIGSTLASATLRLLFDLNNDVCSKKHDVFLGSSPSG----------SD 169

  Fly   151 LQGVFIEFLITCCLVMVACSVWDPRNA--KLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLG 213
            ||...:||:||..|::|.|:|...:..  :|:..:   .|.||:..::.||..:||||||.||:|
plant   170 LQAFVMEFIITGFLMLVVCAVTTTKRTTEELEGLI---IGATVTLNVIFAGEVSGASMNPARSIG 231

  Fly   214 PA-VWNDSWAHHWIYWVGPLVAGAVTSLIYRM 244
            || ||. .:...|||.:.|.:.....:||::|
plant   232 PALVWG-CYKGIWIYLLAPTLGAVSGALIHKM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 67/225 (30%)
NIP2;1NP_180986.1 MIP 6..283 CDD:412216 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.