DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Aqp9

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001258772.1 Gene:Aqp9 / 64008 MGIID:1891066 Length:321 Species:Mus musculus


Alignment Length:232 Identity:65/232 - (28%)
Similarity:107/232 - (46%) Gaps:35/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FIACMGCVETPLFQNSHFRSG------LTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGW 100
            |...:||........|..::|      :.|..|:::|:.....|||.|:|||::.|...:|.:.|
Mouse    61 FYLVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEW 125

  Fly   101 IRAIAYFVAQAAGALIG--------YGLLVAVLPGN-SIKGVDNPSGVCVTILAPGISVLQGVFI 156
            .:...|..||..||.:|        |..|:|...|. .|.|.:..:.:..|...|.:|| .|.|:
Mouse   126 FKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSV-PGAFV 189

  Fly   157 EFLI-TCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLILTAGLFTGASMNPTRSLGP----- 214
            :.:: |..|:::..:::|.||..:...: |:..||.:..:..:.||.:|.:|||.|.|.|     
Mouse   190 DQVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTA 254

  Fly   215 -AVW--------NDSWAHHWIYWVGPLVAGAVTSLIY 242
             |.|        |:.|   ||..|||::...:..|||
Mouse   255 LAGWGFEVFTFGNNFW---WIPVVGPMIGAVLGGLIY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 65/232 (28%)
Aqp9NP_001258772.1 MIP <61..292 CDD:294134 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830754
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.