DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp3b

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001159593.1 Gene:aqp3b / 568049 ZFINID:ZDB-GENE-040724-66 Length:299 Species:Danio rerio


Alignment Length:261 Identity:69/261 - (26%)
Similarity:110/261 - (42%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFIACMGCVETPLFQNSH---FRSGLTFGLAILIAIQCFGSVSGAHLN 85
            |.|:|    |...|.:.|...|....:..|...||   ......||.|..:.|...|.|||.|:|
Zfish    23 RQALA----ECLGTLILVMFGCGALAQHILSGGSHGMFLTVNFAFGFAATLGILVCGQVSGGHIN 83

  Fly    86 PAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVL--------PGN-SIKGVDNPSGVCV 141
            |.:|.:..|.|...|.:...||:||..||.:|.|::..:.        .|: .:.||:..:|:..
Zfish    84 PTVTFSLCLLGREPWRKFPVYFLAQTVGAFLGAGIIFGMYFDAIWKFGQGSLDVDGVNATAGIFA 148

  Fly   142 TILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGL---TVSCLILTAGLF-- 201
            |..:..:::|.|.|.:.:.|..|::...::.||.|.      |:..||   ||..::|..||.  
Zfish   149 TYPSKHLTLLNGFFDQMIGTAALIVCILAIVDPYNN------PIPQGLEAFTVGFVVLVIGLSMG 207

  Fly   202 --TGASMNPTRSLGPAV------WNDSWAHHWIYW-----VGPLVAGAVTSLIYRMA----FKGD 249
              :|.::||.|.|||.:      |.........||     ..|.:......::|::.    .||:
Zfish   208 FNSGYAVNPARDLGPRIFTAIAGWGSKVFSAESYWSFVPVFAPFIGAVFGVMVYQLMVGCHVKGE 272

  Fly   250 E 250
            |
Zfish   273 E 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 63/243 (26%)
aqp3bNP_001159593.1 MIP 23..264 CDD:238204 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.