DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp8a.2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001073651.1 Gene:aqp8a.2 / 563130 ZFINID:ZDB-GENE-070112-1802 Length:257 Species:Danio rerio


Alignment Length:253 Identity:75/253 - (29%)
Similarity:120/253 - (47%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKQKSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTF 65
            :::.|.|.|..          ::|....| ..||..|..||||.|:..:|. :......:..|..
Zfish    18 LNRDKPKPQSK----------YERIFQPC-IAELVGTTFFVFIGCVSVIEN-VEAAGRLQPALVH 70

  Fly    66 GLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSI 130
            |||:.:.:.|...:||:|.||..|:|.||.|.:.....:.|.::|..|.::|..:...:   .|.
Zfish    71 GLAVAVLVACMAEISGSHFNPPFTIAIWLCGGMQLTMVVPYLISQLIGGVLGAAMSKVM---TSD 132

  Fly   131 KGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQD-SVPVRFGLTVSCL 194
            :...|.:|....:|.....:.:.||.|..:||.:.:|.  :....|.|.:. .||...|.||...
Zfish   133 ENYANATGAAFAVLKSDEQLGKVVFAEMAMTCLVTLVV--LMGAVNGKSKSPMVPFMVGCTVIVN 195

  Fly   195 ILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEI 252
            ||..|..:|..:||.|:.|||:..:.|.:||:||||||..|.|.:.:.|:.. |||::
Zfish   196 ILAGGDVSGTCLNPARAFGPALVANHWTYHWVYWVGPLGGGLVAAALMRLLL-GDEKL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 66/214 (31%)
aqp8a.2NP_001073651.1 MIP 36..246 CDD:294134 68/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.