DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp1a.2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001129154.1 Gene:aqp1a.2 / 559284 ZFINID:ZDB-GENE-100409-1 Length:269 Species:Danio rerio


Alignment Length:259 Identity:89/259 - (34%)
Similarity:122/259 - (47%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFR-------SGLTFGLAILIAIQCFGSVSG 81
            |:.:|.|.|    ..:||||.....:     .|.|.|       ..|.|||||....|..|.:||
Zfish    12 RAVLAEFVG----MTIFVFIGIASAI-----GNKHNRYPDQEVKVALAFGLAIATLAQSLGHISG 67

  Fly    82 AHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAP 146
            |||||||||...:...|.:.||..|.:||..||::..|::..|.|       |..:.:.:.:|..
Zfish    68 AHLNPAITLGLLVSCQISFFRAFMYIIAQMLGAVLASGIMFKVSP-------DPDTTLGLNMLGN 125

  Fly   147 GISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRS 211
            |:.|.||..||...|..||:.|.:..|.....:..|.|:..||:|....|.|..:||..:||.||
Zfish   126 GVKVGQGFAIELFTTFQLVLCALATTDKNRTDVSGSAPLAIGLSVGLGHLVAISYTGCGINPARS 190

  Fly   212 LGPAVWNDSWAHHWIYWVGPLVAGAVTSLIY-------------RM-AFKGDEEIDLRTSDAKI 261
            .||||..:|:.:|||||:.|:..|...:|||             || ..||..:.|...::|.|
Zfish   191 FGPAVVLESFKNHWIYWIAPMCGGVAAALIYDFLLFPKREALRKRMNVLKGTADPDPSATEALI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 80/233 (34%)
aqp1a.2NP_001129154.1 MIP 4..221 CDD:278651 80/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.