DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp8b

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001108382.2 Gene:aqp8b / 555598 ZFINID:ZDB-GENE-080220-47 Length:254 Species:Danio rerio


Alignment Length:261 Identity:79/261 - (30%)
Similarity:129/261 - (49%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKQKSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSH-FRSGLT 64
            |.:..|:::...|       |.....:.....||..||.||.:.|:..:|:.  |..| .::.|.
Zfish    11 MDKMVQETEMEEP-------GLFEQLVQPCMAELVGTAFFVLMGCLCVIESA--QEGHTLQAALV 66

  Fly    65 FGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNS 129
            .|||:.:.|.|...:||:|.||:.|:|.:|.|.:.....:.|.::|.:|.|:|     ||:    
Zfish    67 HGLALAVVIGCMVEISGSHFNPSFTIAVFLSGGLELKMVLPYLISQVSGGLLG-----AVM---- 122

  Fly   130 IKGVDN------PSGVCVTILAPGISVLQGVFIEFLITC--CLVMVACSVWDPRNAKLQDSV-PV 185
            .||:.:      ..|...|:|.....:::.:|.|..:||  .|.::..:|    |.|.::.: |.
Zfish   123 AKGMTSSEKYAQAQGAAFTVLQADDHIMKALFAEAAMTCLATLAVLLSAV----NGKSKNHMFPF 183

  Fly   186 RFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDE 250
            ..|.||...:|.....:||.:||.|:|||||..:.|.|||||||||:..|.:.:.:.|: |.||.
Zfish   184 LVGCTVMVNVLAGANVSGACLNPVRALGPAVLTNYWTHHWIYWVGPITGGLIAAALVRL-FLGDN 247

  Fly   251 E 251
            :
Zfish   248 D 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 71/223 (32%)
aqp8bNP_001108382.2 MIP 33..243 CDD:294134 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.