DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and mipb

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001018356.1 Gene:mipb / 553420 ZFINID:ZDB-GENE-050706-86 Length:263 Species:Danio rerio


Alignment Length:260 Identity:81/260 - (31%)
Similarity:117/260 - (45%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAI 88
            |:..|.|||    |..|||......:.........|.:.|.||.|....||..|.:||.|:|||:
Zfish    11 RAVFAEFFG----TMFFVFFGMGAALRWTTGPYHVFHTALCFGFAAATLIQSIGHISGGHINPAV 71

  Fly    89 TLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQG 153
            |.|..:...:...||..|..||..||:.|...|..|.| |:::|.     :.:..|.||:|:...
Zfish    72 TFAYLVGSQMSVFRAFFYICAQCLGAMAGAAALYGVTP-NNMRGT-----MALNTLQPGMSLGMA 130

  Fly   154 VFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWN 218
            ..:|..:|..||:...:|.|.|......|..:..|.:|:...|....:|||.|||.||..|||..
Zfish   131 TTVEVFLTMQLVVCVFAVTDERRNGRLGSAALSIGFSVTMGHLMGMYYTGAGMNPARSFAPAVIT 195

  Fly   219 DSWAHHWIYWVGPLVAGAVTSLIY-------------RMA-FKGD-------------EEIDLRT 256
            .::.:||:|||||::..|:.::.|             |:| .||.             |.|:|:|
Zfish   196 RNFINHWVYWVGPMIGAAMGAIFYDFFLFPRMRGFSERLATLKGSRPPEAENQQETRGEPIELKT 260

  Fly   257  256
            Zfish   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 71/226 (31%)
mipbNP_001018356.1 MIP 3..219 CDD:294134 72/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573529
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.