DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001015749.1 Gene:aqp2 / 548466 XenbaseID:XB-GENE-481401 Length:273 Species:Xenopus tropicalis


Alignment Length:227 Identity:83/227 - (36%)
Similarity:116/227 - (51%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IACFFGELAATAVFVFIACMGCVET--PLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAIT 89
            :...|.|..||.:|||:. ||...:  |...|. .:..|.|||||...:|.||.:||||:|||:|
 Frog    11 VRAVFAEFLATMIFVFLG-MGSALSWKPSLPNV-LQISLAFGLAISTLVQAFGHISGAHINPAVT 73

  Fly    90 LAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLP----GN-SIKGVDNPSGVCVTILAPGIS 149
            :|..:...|.::||:.|.:||..||:.|..::.|:.|    || :|..|.|.|        ||  
 Frog    74 IAFLIGCHISFLRALFYIIAQLVGAIAGAAIVSAIAPLDARGNLAINEVTNGS--------PG-- 128

  Fly   150 VLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGP 214
              |...:|..:|..||:...:..|.|.:....|..:..||:|:...|.....||.||||.||.||
 Frog   129 --QACAVELFLTFQLVLCVFASTDSRRSDNVGSPAISIGLSVTVGHLLGIYLTGCSMNPARSFGP 191

  Fly   215 AVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAF 246
            |.....:..||::|:||||.|.:.||.|...|
 Frog   192 AAITGIFTDHWVFWIGPLVGGILASLFYNYIF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 82/220 (37%)
aqp2NP_001015749.1 MIP 4..219 CDD:333943 81/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.