DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp4

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001345242.1 Gene:aqp4 / 445293 ZFINID:ZDB-GENE-040724-152 Length:346 Species:Danio rerio


Alignment Length:232 Identity:83/232 - (35%)
Similarity:121/232 - (52%) Gaps:11/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GELAATAVFVFIACMGCVETPLFQNSH-----FRSGLTFGLAILIAIQCFGSVSGAHLNPAITLA 91
            ||..|..:||.::....:.....|.:.     ....|.|||:|...:||||.:||||:|||:|:|
Zfish    41 GEFLAMIIFVLLSLGSTINWGAKQENPPPADLVLISLCFGLSIATLVQCFGHISGAHINPAVTVA 105

  Fly    92 AWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFI 156
            ......:...:.:.|.:||..||::|..:|..|.|. |::|     |:.||.:...||....:.|
Zfish   106 MVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVTPA-SVRG-----GMGVTSVNEEISAGHAIVI 164

  Fly   157 EFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSW 221
            |.:||..||....:..||:...|:.|..:..||:|....|.|..:|||||||.||.||||....|
Zfish   165 ELIITFELVFTVFATCDPKRNDLKGSAALAIGLSVCIGHLFAIPYTGASMNPARSFGPAVIMVKW 229

  Fly   222 AHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSD 258
            ..||:||||||:.|.:.:.:|...|..|.::..|.:|
Zfish   230 QDHWVYWVGPLIGGILAAAVYEYLFCPDPDLKRRYAD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 79/216 (37%)
aqp4NP_001345242.1 MIP 32..250 CDD:278651 78/214 (36%)
DUF737 <290..>345 CDD:310129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.