DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and mipa

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001003534.1 Gene:mipa / 445140 ZFINID:ZDB-GENE-040801-41 Length:263 Species:Danio rerio


Alignment Length:267 Identity:83/267 - (31%)
Similarity:117/267 - (43%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSG 81
            ||          ..|.|...|..|||......:......::..:....||||....||..|.:||
Zfish    10 WR----------AVFAEFYGTMFFVFFGLGAALRWTTGPHNVLQVAFCFGLAAATFIQSIGHISG 64

  Fly    82 AHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAP 146
            .|:|||:|.|..:...:...||..|..||..|||.|..:|..|.|.| ::|     .:.:..|.|
Zfish    65 GHINPAVTFAYLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTPTN-MRG-----NLALNTLQP 123

  Fly   147 GISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRS 211
            |||:.....||..:|..||:...:|.|.|......|..:..|.:|....|....:|||.|||.||
Zfish   124 GISMGMATTIEIFLTLQLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARS 188

  Fly   212 LGPAVWNDSWAHHWIYWVGPLVAGAVTSLIY-------------RMA-FKGD------------- 249
            ..|||...::.:||:|||||::..|:.:|:|             |:| .||:             
Zfish   189 FAPAVLYRNFINHWVYWVGPMIGAAMGALLYDFMLFPRVRGLSERLAVLKGNKPTEPEAQQETRG 253

  Fly   250 EEIDLRT 256
            |.|:|:|
Zfish   254 EPIELKT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 73/226 (32%)
mipaNP_001003534.1 MIP 3..219 CDD:278651 74/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.