DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp3a

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_998633.1 Gene:aqp3a / 406777 ZFINID:ZDB-GENE-040426-2826 Length:296 Species:Danio rerio


Alignment Length:256 Identity:65/256 - (25%)
Similarity:104/256 - (40%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVETPLFQNSH---FRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWL 94
            |...|.:.|...|....:..|.:.||   ..:.|.||....:.|...|.|||.|||||:|.|..|
Zfish    28 ECLGTLILVMFGCGSLAQLKLSEGSHGLFLTANLAFGFGATLGILVCGQVSGGHLNPAVTFALCL 92

  Fly    95 YGAIGWIRAIAYFVAQAAGALIGYGLLVAV-------LPGNS----IKGVDNPSGVCVTILAPGI 148
            .|...|.:...||:.|..|:.:|..::.|.       ..|.|    :.|....:|:..|..:..:
Zfish    93 LGREKWRKFPVYFLFQTLGSFLGAAIIFAEYHDAIYDYAGESNELLVLGEKETAGIFATYPSKYL 157

  Fly   149 SVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPV-RFGLTVSCLILTAGLFTGASMNPTRSL 212
            :.|.|.|.:.:.|..|::...::.||.|..:...:.. ..|.:|..:.|:.|..:|.::||.|..
Zfish   158 TPLNGFFDQVIGTASLIVCILAIVDPYNNPIPQGLEAFTVGFSVLIIGLSMGFNSGYAVNPARDF 222

  Fly   213 GP------AVWNDSWAHHWIYW-----VGPLVAGAVTSLIYRMAFKGDEEIDLRTSDAKIR 262
            ||      |.|.........||     ..|.:...:..::|::......|.:.|...||.|
Zfish   223 GPRLFTAMAGWGSEVFTARDYWFLVPIFAPFIGAVIGVIVYQLMVGWHVEGEARDKKAKAR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 60/236 (25%)
aqp3aNP_998633.1 MIP 23..266 CDD:238204 60/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.