DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Eglp2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster


Alignment Length:279 Identity:141/279 - (50%)
Similarity:182/279 - (65%) Gaps:18/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKQKSQESNPNAR---------WRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQN 56
            :..|.:.|.|..|:.:         |.|:..|..:|.....|:.|||:.:|:.|||.||..:|.|
  Fly    11 IGHQMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTN 75

  Fly    57 SHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLL 121
            |.|:|.|.||..:||.|||||.|.|||||||:|||.::|..|....|:||||||..||.||||||
  Fly    76 SDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLL 140

  Fly   122 VAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVR 186
            .||||.::|...:||:|||:|.|...::..||:.:||||||.|:.|.|.|||||||..|||:|||
  Fly   141 KAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVR 205

  Fly   187 FGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFK---G 248
            |||.::||.||||..|||||||.||..||:||..|..||||||||:.|..:||:||:.||:   .
  Fly   206 FGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAFRRELE 270

  Fly   249 DEEID------LRTSDAKI 261
            :.|:|      .|||:|::
  Fly   271 ESEVDETTMSTKRTSEAEL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 125/213 (59%)
Eglp2NP_788433.2 MIP 41..261 CDD:294134 125/219 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471468
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 1 1.000 - - H136579
Inparanoid 1 1.050 92 1.000 Inparanoid score I335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26905
OrthoDB 1 1.010 - - D101773at6656
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51414
orthoMCL 1 0.900 - - OOG6_100415
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
1312.810

Return to query results.
Submit another query.