DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Eglp1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611810.1 Gene:Eglp1 / 37736 FlyBaseID:FBgn0034882 Length:238 Species:Drosophila melanogaster


Alignment Length:216 Identity:74/216 - (34%)
Similarity:119/216 - (55%) Gaps:6/216 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGA 97
            |.:|||:.:.:.|||.......::....:.:.:||.:::.:..||.|||||.||.|:::.:|.|.
  Fly    14 EFSATALLILLGCMGDSTNQGGESKFLVASVHYGLTVMVVMHVFGFVSGAHSNPCISISCYLMGY 78

  Fly    98 IGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITC 162
            |.....:.|.|.|.|||.:||.||:.:||...:.  .:..|:|:......:|..|.|.||.|:|.
  Fly    79 IALEVMMMYVVCQMAGAFLGYFLLMQLLPKELVD--KSKPGICLVQPMDTLSTYQVVIIECLLTA 141

  Fly   163 CLVMVACSVWDPRNAKLQDSVPVRFG-LTVSCLILTAGL-FTGASMNPTRSLGPAVWNDSWAHHW 225
            .||:..||:||.||.:..|||.:|.| |.::|..  ||: .|||||||.::|.||::..|.....
  Fly   142 VLVLGWCSLWDVRNGRFLDSVAIRMGLLVIACSF--AGIQLTGASMNPAKTLVPAIFYGSPNSVL 204

  Fly   226 IYWVGPLVAGAVTSLIYRMAF 246
            :...|.::|..:...::..|:
  Fly   205 MQLTGQILAAIMVPFVWNHAY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 73/212 (34%)
Eglp1NP_611810.1 MIP 13..223 CDD:294134 73/212 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471471
Domainoid 1 1.000 93 1.000 Domainoid score I390
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I335
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101773at6656
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100415
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
1110.800

Return to query results.
Submit another query.