DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP9

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_066190.2 Gene:AQP9 / 366 HGNCID:643 Length:295 Species:Homo sapiens


Alignment Length:238 Identity:71/238 - (29%)
Similarity:110/238 - (46%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVETPLFQNSHFRSGLT----FGLAILIAIQCFGSVSGAHLNPAITLAAW 93
            |...|.:.:.:.| |||...:.....|...:|    |.:|:.:||...|.|||.|:|||::||..
Human    29 EFLGTFILIVLGC-GCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMC 92

  Fly    94 LYGAIGWIRAIAYFVAQAAGALIG--------YGLLVAVLPGN-SIKGVDNPSGVCVTILAPGIS 149
            |:|.:.|.:...|..||..||.:|        |..|::...|. .|.|.:..:.:..|..||.:|
Human    93 LFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLS 157

  Fly   150 VLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLILTAGLFTGASMNPTRSLG 213
            :......:.:.|..|:::..:::|.||......: |:..||.:..:..:.||.:|.:|||.|.|.
Human   158 LANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLS 222

  Fly   214 P------AVW--------NDSWAHHWIYWVGPLVAGAVTSLIY 242
            |      |.|        |:.|   ||..|||||...:..|||
Human   223 PRLFTALAGWGFEVFRAGNNFW---WIPVVGPLVGAVIGGLIY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 71/238 (30%)
AQP9NP_066190.2 MIP 1..266 CDD:294134 71/238 (30%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 84..86 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 216..218 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.