DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP7

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001161.1 Gene:AQP7 / 364 HGNCID:640 Length:342 Species:Homo sapiens


Alignment Length:267 Identity:65/267 - (24%)
Similarity:114/267 - (42%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QRSAIACFFGELAATAVFVFIACMGCVETPLFQ---NSHFRSGLTFGLAILIAIQCFGSVSGAHL 84
            ||..:..|..|..:|.|.:... :|.|...:..   .|:....|.||..:.:.:...|.:||||:
Human    30 QRKMVREFLAEFMSTYVMMVFG-LGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHM 93

  Fly    85 NPAITLAAWLYGAIGWIRAIAYFVAQAAGALIG----YGLL-VAVLPGNS----IKGVDNPSGVC 140
            |.|:|.|....|.:.|.:...|.:.|..|:.:.    |.|. .|:|..:.    :.|....:|:.
Human    94 NAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIF 158

  Fly   141 VTILAPGISVLQGVFIEFLITCCLVMVACSVWD-PRNAKLQDSVPVRFGLTVSCLILTAGLFTGA 204
            .|.|...:::.:|...|..:|..|.:...::.| ..|..|..:..:..|:.|..:.::.|:.||.
Human   159 ATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGY 223

  Fly   205 SMNPTRSLGPAV------W-------NDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGD----EEI 252
            ::||:|.|.|.:      |       .::|  .|:..|.||:...:..:|| :.|.|.    |.:
Human   224 AINPSRDLPPRIFTFIAGWGKQVFSNGENW--WWVPVVAPLLGAYLGGIIY-LVFIGSTIPREPL 285

  Fly   253 DLRTSDA 259
            .|..|.|
Human   286 KLEDSVA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 57/239 (24%)
AQP7NP_001161.1 MIP 31..280 CDD:412216 60/252 (24%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 94..96 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 226..228 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140777
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.