DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP4

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001304313.1 Gene:AQP4 / 361 HGNCID:637 Length:352 Species:Homo sapiens


Alignment Length:232 Identity:81/232 - (34%)
Similarity:121/232 - (52%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIAC-----MGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAA 92
            |..|..:||.::.     .|..|.||..:....| |.|||:|...:||||.:||.|:|||:|:|.
Human    41 EFLAMLIFVLLSLGSTINWGGTEKPLPVDMVLIS-LCFGLSIATMVQCFGHISGGHINPAVTVAM 104

  Fly    93 WLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIE 157
            .....|...:::.|..||..||:||.|:|..|.|.:.:      .|:.||::...::...|:.:|
Human   105 VCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVV------GGLGVTMVHGNLTAGHGLLVE 163

  Fly   158 FLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWA 222
            .:||..||....:..|.:...:..|:.:..|.:|:...|.|..:|||||||.||.||||...:|.
Human   164 LIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWE 228

  Fly   223 HHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSDA 259
            :||||||||::...:...:|...|..|.|...|..:|
Human   229 NHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 76/215 (35%)
AQP4NP_001304313.1 MIP 31..248 CDD:278651 75/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140764
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.