DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP3

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_004916.1 Gene:AQP3 / 360 HGNCID:636 Length:292 Species:Homo sapiens


Alignment Length:301 Identity:79/301 - (26%)
Similarity:128/301 - (42%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKQKSQESNP--NARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSH---FR 60
            |.:||:.......  :.|:||   .|.|:|    |...|.:.|...|....:..|.:.:|   ..
Human     1 MGRQKELVSRCGEMLHIRYRL---LRQALA----ECLGTLILVMFGCGSVAQVVLSRGTHGGFLT 58

  Fly    61 SGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAV- 124
            ..|.||.|:.:.|...|.|||||||||:|.|........||:...|.:||..||.:|.|::..: 
Human    59 INLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLY 123

  Fly   125 ------LPGNS--IKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQD 181
                  ...|.  :.|.:..:|:..|..:..:.::.|.|.:|:.|..|::...::.||.|.    
Human   124 YDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNN---- 184

  Fly   182 SVPVRFGL---TVSCLIL----TAGLFTGASMNPTRSLGP------AVWND---SWAHHWIYW-- 228
              ||..||   ||..::|    :.|..:|.::||.|..||      |.|..   :...|| :|  
Human   185 --PVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHW-WWVP 246

  Fly   229 -VGPLVAGAVTSLIYRMAF--------KGDEEIDLRTSDAK 260
             |.||:.......:|::..        ..:||.:::.:..|
Human   247 IVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 67/244 (27%)
AQP3NP_004916.1 MIP 23..264 CDD:238204 70/251 (28%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.869916 Normalized mean entropy S1906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.630

Return to query results.
Submit another query.