DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP2

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_000477.1 Gene:AQP2 / 359 HGNCID:634 Length:271 Species:Homo sapiens


Alignment Length:212 Identity:72/212 - (33%)
Similarity:107/212 - (50%) Gaps:6/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLY 95
            |.|..||.:|||......:..|....|..:..:.|||.|...:|..|.:||||:|||:|:|..:.
Human    14 FAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVG 78

  Fly    96 GAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLI 160
            ..:..:||..|..||..||:.|..||..:.|.: |:|     .:.|..|:...:..|.|.:|..:
Human    79 CHVSVLRAAFYVAAQLLGAVAGAALLHEITPAD-IRG-----DLAVNALSNSTTAGQAVTVELFL 137

  Fly   161 TCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHHW 225
            |..||:...:..|.|..:...:..:..|.:|:...|....:||.||||.|||.|||....:..||
Human   138 TLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHW 202

  Fly   226 IYWVGPLVAGAVTSLIY 242
            ::|:||||...:.||:|
Human   203 VFWIGPLVGAILGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 72/212 (34%)
AQP2NP_000477.1 MIP 3..219 CDD:278651 71/210 (34%)
NPA 1. /evidence=ECO:0000305|PubMed:24733887 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:24733887 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140759
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.