DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and AQP8

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011544124.1 Gene:AQP8 / 343 HGNCID:642 Length:262 Species:Homo sapiens


Alignment Length:264 Identity:91/264 - (34%)
Similarity:131/264 - (49%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVE----TPLFQNSHFRSGLTFGL 67
            |::|.:...|||:..::|....|.. ||..:|:|:||.|:..:|    |.|.|     ..|..||
Human    17 KAREPSVGGRWRVSWYERFVQPCLV-ELLGSALFIFIGCLSVIENGTDTGLLQ-----PALAHGL 75

  Fly    68 AILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKG 132
            |:.:.|...|::||.|.|||::|||.|.|.:..:..:.|:|:|..|.::|..|..||.|..... 
Human    76 ALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFW- 139

  Fly   133 VDNPSGVC-VTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLI 195
              |.||.. ||:...| .|...:..|.::|..|.:..|  ....|.|.:..: |...|..|:..|
Human   140 --NASGAAFVTVQEQG-QVAGALVAEIILTTLLALAVC--MGAINEKTKGPLAPFSIGFAVTVDI 199

  Fly   196 LTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSDAK 260
            |..|..:|..|||.|:.||||..:.|..|||||:|||:||.:..|:.| .|.|         |.|
Human   200 LAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR-CFIG---------DGK 254

  Fly   261 IRMI 264
            .|:|
Human   255 TRLI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 77/219 (35%)
AQP8XP_011544124.1 MIP 39..232 CDD:294134 70/204 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140794
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4525
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.