DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp1a.1

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_996942.1 Gene:aqp1a.1 / 335821 ZFINID:ZDB-GENE-030131-7764 Length:260 Species:Danio rerio


Alignment Length:244 Identity:83/244 - (34%)
Similarity:119/244 - (48%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKQKSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQN--SHFRSGL 63
            |::.|.|       |.||          ....||....:|:|::....|.....||  ...:..|
Zfish     1 MNELKSK-------AFWR----------AVLAELLGMTLFIFLSITAAVGNTNTQNPDQEIKVAL 48

  Fly    64 TFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGN 128
            .|||:|....|..|.:||||||||:||.......|..:||:.|.:||..||.:...:::.|..|:
Zfish    49 AFGLSIATLAQSLGHISGAHLNPAVTLGLLASCQISLLRAVMYILAQMIGATVASAIVLGVSKGD 113

  Fly   129 SIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSC 193
            :: |::.        :...||..|||.||.|.|..||:...:..|.|...:..|.|:..||:|..
Zfish   114 AL-GLNQ--------IHTDISAGQGVGIELLATFQLVLCVLATTDKRRRDVSGSAPLAIGLSVCL 169

  Fly   194 LILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIY 242
            ..|||..|||..:||.|:.|||:....:|:||:|||||:..|...:|||
Zfish   170 GHLTAISFTGCGINPARTFGPAMIRLDFANHWVYWVGPMCGGVAAALIY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 77/215 (36%)
aqp1a.1NP_996942.1 MIP 3..218 CDD:278651 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.